NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308402_1009717

Scaffold Ga0308402_1009717


Overview

Basic Information
Taxon OID3300032033 Open in IMG/M
Scaffold IDGa0308402_1009717 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2283
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. SCN 71-131(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010840Metagenome / Metatranscriptome298Y
F016404Metagenome / Metatranscriptome247N
F051735Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0308402_10097172F016404N/AMTVDELLTDEARAAVLRALFMIVVNDNEPASARVAAARLFLSQFDEQPNAERDVLVIVDEAAFVKTV
Ga0308402_10097173F010840AGGAGGVNLPFSQPLDKVTFGALAAATIIVLTWALREFVGIELPAEVQAALAVIFGYVVSYHTPLTEAEAEAIARKYYKYK
Ga0308402_10097174F051735AGGAGGMFRDVTIINGPVPKDGVADYERLRIKARPLGRPYAWDNGRAWNSYVTNGGFILVFECEDGAVYIQEIEWEVDPYPDATPDPRTYYYYERYNSLAEARAGGRGWLIEYALGIE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.