NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326508_1268895

Scaffold Ga0326508_1268895


Overview

Basic Information
Taxon OID3300032037 Open in IMG/M
Scaffold IDGa0326508_1268895 Open in IMG/M
Source Dataset NameMetatranscriptome of bovine rumen microbial communities from UC Davis, California, United States - 1_2617_0518 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)534
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5357Long. (o)-121.7593Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006460Metagenome / Metatranscriptome372N

Sequences

Protein IDFamilyRBSSequence
Ga0326508_12688951F006460N/AASESRFFQMVPRSNEAQIELMNVVMSEKVRLYNRGDYMEVTFFLPNGEDLMVQLPRESLKMPMINPNLGQSIQQSVVYDPTTGTSRIQTSVVNTPGTKRSLYDEIRMRPGFGTPFVDSYGDEGFFDSGLPSKLGSTIGNSNIGLTNSGIGGATLANSGYGINPNL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.