NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308400_1001449

Scaffold Ga0308400_1001449


Overview

Basic Information
Taxon OID3300032045 Open in IMG/M
Scaffold IDGa0308400_1001449 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7641
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (81.25%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000642Metagenome / Metatranscriptome965Y
F004024Metagenome / Metatranscriptome456N
F059548Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0308400_100144911F004024AGGAMRSERDYVRQPLNDDDMMFLDARATLAAALARAVVGYSDSRVRALAWLAVATPRLYDRVAPIVESAAIRQSPGASRTLRDALRALSLEEYVRRRDDRRSDR
Ga0308400_100144916F059548AGGGGGMPTRREDALWSVVHQRASHLRALLDGLDDVDVSIAYE
Ga0308400_10014499F000642N/AMRHGAVREGASPSGGAVNGAQLRVLGRAWRAVGGAMQEISIALAICAVGAAVWYMRRRDAGAGRVRGWLLLYDDVGGWRVLPAAYGDSGVVADGVTYPASLPVVRVDRTLVWIARCDAAALIEHQALERAREAAALASLWRGGGQWIDFLRVAGVVLPAAFAYFTWSQVAALQALVAQILALVGER
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.