NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308416_1000496

Scaffold Ga0308416_1000496


Overview

Basic Information
Taxon OID3300032049 Open in IMG/M
Scaffold IDGa0308416_1000496 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13804
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (86.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000642Metagenome / Metatranscriptome965Y
F002795Metagenome / Metatranscriptome529Y
F002978Metagenome / Metatranscriptome516Y
F004024Metagenome / Metatranscriptome456N

Sequences

Protein IDFamilyRBSSequence
Ga0308416_10004961F004024AGGAGGMHSERDYVRQPSSLNDDDMMFLDARATLAAALARAVVGYSDSRVRALAWLSIATPRLYERIAPIIEASAIRQSPGASRTLRDALRALSLEEYVRRRDERRSDR
Ga0308416_100049613F000642GAGGVQEISIALALCAVGAAVWYMRRRDAGAGRVTGWLLLYDAVGGWRVLPASYGDAGVVADGVTYPVSLPALRVGRELVWIARCDAAALIEHQALERAREAAALASLWRGGGQWLDLLRVLGVVLPAVFAYFTWSQVSALQSLVAQILVGER
Ga0308416_100049619F002795GGAGGMARPDGLILRGMVASYREFVSRKDGRLFRVITVYGDLVVGEAVLCTVDGYDVFVDSPHYARGELVELPARLQFVRDSSGRPALRLYVDEGVR
Ga0308416_100049629F002978GAGGVSVRDWRVTVVPWADRRLWFIQARRGRRVIWGVVYDASDPDSVALARRAIATLRAADADCSALPSPLPGVGQEP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.