NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308416_1036834

Scaffold Ga0308416_1036834


Overview

Basic Information
Taxon OID3300032049 Open in IMG/M
Scaffold IDGa0308416_1036834 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1068
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005028Metagenome / Metatranscriptome414Y
F032180Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0308416_10368341F032180AGGAMWWKIEEVPYQELEDWAHAVGCFERAAKRDVAVRAAGAFVIYDLDGKLGYVAGREAPEGAYVVERWVRGKRGWT
Ga0308416_10368342F005028AGGAGMRDDDLHAAMRFFAERLRGAEADETRLRRWTRHKLRNDAQAVAELMLTVGYRPMYIRYFLRYHIRAVDLESDSEDVVLVVADLHAAAKRLKQPYRDLAAVCLKWGYVHETVVQMLAKILERKQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.