NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308310_1017909

Scaffold Ga0308310_1017909


Overview

Basic Information
Taxon OID3300032056 Open in IMG/M
Scaffold IDGa0308310_1017909 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2448
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013092Metagenome / Metatranscriptome274N
F022362Metagenome / Metatranscriptome214N

Sequences

Protein IDFamilyRBSSequence
Ga0308310_10179092F013092GAGMNATLDVFFKTLLRSRGVRLRLPNGSEIDAVVARRDSQSVSLGGQVAADTTTQCFVVRASDLPAGYWPRVADEIVNVATSHRYIVVRAIGGAHATTSSDPYGFLVRVWTRLAS
Ga0308310_10179094F022362GGAMIANLLDAVVDALNGPPPAASVAASKAWAHYWVLARETPDVCVVTFVRSERERLSRSRFRFLLDVEVVRARPYVDASSIETVVNDAHSIASRLTSEEVLERGGIAYAFESISFSDPLYEIEEVFDESSFVRASITARYAVLEPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.