NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318514_10422472

Scaffold Ga0318514_10422472


Overview

Basic Information
Taxon OID3300032066 Open in IMG/M
Scaffold IDGa0318514_10422472 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)708
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019070Metagenome / Metatranscriptome231Y
F031725Metagenome / Metatranscriptome181Y
F044845Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0318514_104224721F031725N/AAAEGRKRIDELLHELADARTAAMITGCEAAALRSRLEILTDERRRPWWRGWFR
Ga0318514_104224722F019070GGAGMQTMLNIALAAVGFALAAIPAFAVEMPTDGSKNFTSPTDAPSYFTSETLPESARFDRAASFDEEDVGATTPDVGDTTQYDRHTSPHESARHSPGKSKGRSASAHYAK
Ga0318514_104224723F044845N/AMTSGASVTLHALEAALIQCHATSTRDGCVPLSVHATMAECRALAREYQKFDTRALGVTGLPAVVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.