NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315903_10170046

Scaffold Ga0315903_10170046


Overview

Basic Information
Taxon OID3300032116 Open in IMG/M
Scaffold IDGa0315903_10170046 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1975
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.7464Long. (o)-83.3444Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013888Metagenome / Metatranscriptome267Y
F037690Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0315903_101700462F013888GGAMYTIGVLPASGKASRIGGIPKFCLPISDERSLLQWHVEQMLEVCDEVRVATRPEWVPIVQNMDMNIKLIVREPSTMSDAIKFMIGDYNDTVVVGMPDTYILNAPVNIYKEMMKEDKADLVLGVWECVEELKGRVGQVKVSDGRVIASEDKVDNCDYPDMWGTMLFRKNMIRYLDPKLDHPGKQLKEWISEGTNIRAVRPGGRYMDIGTLRGLKNLYKEMDNA
Ga0315903_101700465F037690N/AASVITISPTSWQAYIGNKNPTKMEKDKLRFENPGYADSWYKNKMRQIRKQRTVDYFNSKYSLQLDDFDVADAFGIAHYSNTVLTER
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.