NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310895_10003697

Scaffold Ga0310895_10003697


Overview

Basic Information
Taxon OID3300032122 Open in IMG/M
Scaffold IDGa0310895_10003697 Open in IMG/M
Source Dataset NameLab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4136
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005575Metagenome / Metatranscriptome396Y
F005830Metagenome / Metatranscriptome389Y
F026078Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0310895_100036971F005575AGGAGMRTLFGIGLTIFAVALVITTWSVEPTVGKTPNVSVDPLGMMVNTGGLPQAHYTDY
Ga0310895_100036974F005830AGGAGMKKQWEPERSRVEHANDARITFTIALHGDHAWEMLLEDSKSYHSISHGWATDNPQDWEAIIAPALCRLFPDDRLRLATKAPIDAPGGSCAGVALYDPPLCSPATRAEDNLSDGWRKQAIA
Ga0310895_100036975F026078N/AVVAATIWWTFPIQAKQQFDHDSIDPLAMTGTVTNLLPEVHYDHGFVFPEQQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.