Scaffold Ga0316201_11156921

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316201_11156921

Scaffold Ga0316201_11156921

Overview

Basic Information
Taxon OID	3300032136 Open in IMG/M
Scaffold ID	Ga0316201_11156921 Open in IMG/M
Source Dataset Name	Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	647
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Delaware
Coordinates	Lat. (^o)	38.7869	Long. (^o)	-75.1074	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051941	Metagenome / Metatranscriptome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0316201_111569211	F051941	AGGA	MATSFKNMIYDLTPTTSEQTVYGIPTDSHSIINAFYVNNTGGSTINIEVRLDRGPGRNYVASQTIVFSTPLTSGQYLNLLTGPLVLEGGDKLVFTTNTTGRVQGTIAAMQVNREDQETTPIG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.