NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316585_10055468

Scaffold Ga0316585_10055468


Overview

Basic Information
Taxon OID3300032137 Open in IMG/M
Scaffold IDGa0316585_10055468 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1275
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location
Location NameUSA: Alabama
CoordinatesLat. (o)30.2619Long. (o)-88.2383Alt. (m)Depth (m)0 to .07
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060598Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0316585_100554681F060598N/ANGTRRISLVGHNLPRWTRLVDLVKGKIGNTGRILKAEELVLAYDLDALRWLSLRVYQGTKKLSKGLIEIVRELLKHRGTLDGLLRLFFDKGGYSGQNFRALADEPTVHFYTPAVRYPDSVAQWEQLQETDFDSEPFVFDKHADLPVGERPAYRLADTEMTINVWQKQKVVDTVTLRAIVVHDPQGEKPAERWPVVLLTDDRQIDARDLLNEFGDHWGQEFGHRIGKHDLYLDILPQGYVLRTQRDDEGQLHREVEYDQTALFLSAWLRCLVFNLMSRFAQAVGGEYAKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPGQDELQPLLDRLNAKRTPLPWLNDLIVQFSIAQDEPLHPLTEPEKRNRLFGDGEHQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.