NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315292_10415921

Scaffold Ga0315292_10415921


Overview

Basic Information
Taxon OID3300032143 Open in IMG/M
Scaffold IDGa0315292_10415921 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1130
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5395Long. (o)-110.3891Alt. (m)Depth (m)61
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013725Metagenome / Metatranscriptome269Y
F097175Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0315292_104159212F097175N/AMKTYYILIGNCEELLNDFIEALFQGVCEGKAVVKFTRAARAGDLVREACEREFDLVVQVPHNLLSEVSDPTPIGFITEAIRAIQIIKSRRPVPVISIVAPEERSRYEPLLLEAGADCVLELPFEGGQLTSAVGRLLPFPARLEYAPTKRWFFAGVLMRGLRRLAQA
Ga0315292_104159213F013725GGCGGMETNSPGPLAQGQVWKTRAADIEIVALGERLIHYRITRQFGQKRVSAQISGIEAMANYLATNTARLVKGPSTN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.