NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315910_10744726

Scaffold Ga0315910_10744726


Overview

Basic Information
Taxon OID3300032144 Open in IMG/M
Scaffold IDGa0315910_10744726 Open in IMG/M
Source Dataset NameGarden soil microbial communities collected in Santa Monica, California, United States - Edamame soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)762
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.0136Long. (o)-118.4673Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074077Metagenome120Y
F097781Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0315910_107447261F097781N/ALDELARACAAGGPRTRAQFAACGALRPYKWYAAAYKGDALDPGWTKAIAVLVERNWIVESGRIHGAGDHGPNPAAEIALQVAGRHAGQLKDVAP
Ga0315910_107447262F074077AGGAVKPASALRKRASATVGVPLTWAFDGRFQGCLADLEDALRRAIVQVGDVSRVLVVIELALPALKSRMEKGDAIQPAWSEFLARVTSHYGLPAAPRFRYLTHEAPLLALVIAWRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.