NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315912_10000239

Scaffold Ga0315912_10000239


Overview

Basic Information
Taxon OID3300032157 Open in IMG/M
Scaffold IDGa0315912_10000239 Open in IMG/M
Source Dataset NameGarden soil microbial communities collected in Santa Monica, California, United States - V. faba soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)117047
Total Scaffold Genes120 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)96 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.0136Long. (o)-118.4673Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075051Metagenome119Y
F092005Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0315912_1000023927F092005GAGGVIRSLVLFVHVICVLTMFASLALEAFGGQPSGKATPRVFGLAAPLTVLSGFYLGARFGVLGNEWIRASYGGIVAMIAAGTLARRSEALRRISLSARAAFGLAVVFLMIAKPDGVVSLVVLGLALAVSILVAASIALRPPTSLSSTEA
Ga0315912_1000023958F075051GGAMEIFDWQDRRDLNVPRAIIQQGRCEQNQCGQFSISISNGQRGMTIRFESEAEFRQFLERGEAEKR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.