NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311301_10608269

Scaffold Ga0311301_10608269


Overview

Basic Information
Taxon OID3300032160 Open in IMG/M
Scaffold IDGa0311301_10608269 Open in IMG/M
Source Dataset NameSb_50d combined assembly (MetaSPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1572
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000072Metagenome / Metatranscriptome2651Y
F000540Metagenome / Metatranscriptome1043Y

Sequences

Protein IDFamilyRBSSequence
Ga0311301_106082692F000540GGAMTKKRDGSLLPKLTEAEQDLLSHIQDGYQLETDSLGGNPILRRLKDNEEIRPLSANRNTIKALEKRGLISLGKGRDPLTIVWRLKKK
Ga0311301_106082693F000072GAGMDVERIIDDIEQLQEMFEAPDIRPLSASDIFAANRRHDETLAHSPWFRLWQRYGVCCRSEAPVIRLDEVEN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.