NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315268_10069088

Scaffold Ga0315268_10069088


Overview

Basic Information
Taxon OID3300032173 Open in IMG/M
Scaffold IDGa0315268_10069088 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3331
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5106Long. (o)-110.3566Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038201Metagenome / Metatranscriptome166N
F045645Metagenome152N

Sequences

Protein IDFamilyRBSSequence
Ga0315268_100690882F045645AGGMKLQETALRMLKSVAGVFHVRPIIPDRALTLRKGRRGHELIQNEGEAVRVVAVSDDKPGLLSFAALNGIPVKNYTDMAVPKPETTNKDAAQVPELSM
Ga0315268_100690883F038201N/AMDVFTRNVQFMVSQVAGEHAGQTFQMLQRTFPGLRNFEQLRTFAKLYVNSGLNPLQLRPLPSDVDPHGLKGELALRFCGGIIVLAKDERIVCRGAEAYGPFDPIQAASFSRKLSAESPTNDDRGHALDPEQCVPSPVGVYPEIA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.