NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315268_10360187

Scaffold Ga0315268_10360187


Overview

Basic Information
Taxon OID3300032173 Open in IMG/M
Scaffold IDGa0315268_10360187 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1417
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5106Long. (o)-110.3566Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008495Metagenome / Metatranscriptome332N
F020694Metagenome / Metatranscriptome222N

Sequences

Protein IDFamilyRBSSequence
Ga0315268_103601872F008495N/AMAEYHGLFAMVDYCRPIYPQNDHSGFDRIINLQIWPDLHEDFCASPLGWSDYVYGLLPEGKDIDRQIVLNSPAIVTPPELKAWVLCFPTGFSQDKKIEPRDVIAVAHHVANGRPVLCAGKAAHGMAEFDSIEYMCAYIRDANEVVTINTSTSILSSALRKSWVHISDSPKHDFTHPNQRRIERKF
Ga0315268_103601873F020694N/AMLDIFTSDLAAMLDELPVVVTFGDATFVANRTTYRRDNSLADGGFMNTSATNITAIYSAVVQTISLGDILVIGGTRLRVTSAELSQDAVSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.