NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310889_10246005

Scaffold Ga0310889_10246005


Overview

Basic Information
Taxon OID3300032179 Open in IMG/M
Scaffold IDGa0310889_10246005 Open in IMG/M
Source Dataset NameLab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)846
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022477Metagenome / Metatranscriptome214Y
F036451Metagenome / Metatranscriptome170N

Sequences

Protein IDFamilyRBSSequence
Ga0310889_102460051F036451GAGVATLVHTGSKIIVEVLDGEILVTMPGTSFSVVYEKTKNNRLIASSFTGRKVRDERSRMSFPHFLSLAWTAANEKAKEIGWIVSVRAN
Ga0310889_102460053F022477N/APNGVWACTKPINIKGPNGPVVISQGASFSPGASFMGLDLANELDQMAAKHGFRSQASAGGVMATRTSA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.