NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307472_100076906

Scaffold Ga0307472_100076906


Overview

Basic Information
Taxon OID3300032205 Open in IMG/M
Scaffold IDGa0307472_100076906 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2202
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055023Metagenome139Y
F089292Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0307472_1000769062F089292AGGAGMVKWLLSFLLQRLLILFVLVVASAIFPVASFWLVRDPLGGQPFFWLSPWTCAVWAVLVSVLIGSRFWLGREYVLAWRAARGGYVMSSLKSTALMSVVLLASYACEFAVILLLPRSPTSLRLLPIAAHAPAGIAALWSVSGGVRSRTDRIIEGRRLAHSMNEEPE
Ga0307472_1000769063F055023AGGAGMKTEDKLDAEIAKLFDEVTTTKVEMVNDKPRISDQATLDQMEREEAARRMEEACGMFLTADRRFQKLNGHPDKVADPKVNLAWWESLEQVYERERVVWRLFVGPQPTMADNKLYAKFRKLLLEGSKLKGDA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.