NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316205_10243372

Scaffold Ga0316205_10243372


Overview

Basic Information
Taxon OID3300032257 Open in IMG/M
Scaffold IDGa0316205_10243372 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)651
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Maine
CoordinatesLat. (o)43.8603Long. (o)-69.5781Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087884Metagenome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0316205_102433721F087884N/AMEHTESYNITVGQYQALNDIDEGLSLIEQNIYAVAALKNITYEQAAKIKMSEFKKIVEIIQEFNVTLLEKIRIKNKVFLNGTEYHLEHKPDKLTSGQLLDVINIRSKHQGEAVKVMDLLLAAMSRPKGKEYGDDKLTLTERAALFKDVNLEEVWNVFVFFWNLWNDYFLDSEASLRKWMGETVEMTRDILNKDGDYLA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.