NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314683_10386707

Scaffold Ga0314683_10386707


Overview

Basic Information
Taxon OID3300032617 Open in IMG/M
Scaffold IDGa0314683_10386707 Open in IMG/M
Source Dataset NameMetatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)874
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway

Source Dataset Sampling Location
Location NameNorway: Bergen
CoordinatesLat. (o)60.2696Long. (o)5.2187Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018867Metagenome / Metatranscriptome232N
F026010Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0314683_103867071F026010N/AKNLVTDKTTPVTGSLVQLDTEKSDADGLFKLMDANVTRGNLKNLVTDKPSPITVGLAQKSDADGLFKLMDANVTRGNLKNLVTDKPSPITVGLAQKSDADGLF
Ga0314683_103867072F018867N/AMDANVTRGNLKNLVTDKPSPITVGLAQKSDADGLFKLMDANVTRGNLKNLVTDKPSPITVGLAQKSEADGLFKLMDANVTRGNLKNLVTDKPSPITVGLAQKSDADGLFKLMDANVTRGNLKNLVTDKPSPITVGLAQTKS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.