NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214494_1009095

Scaffold Ga0214494_1009095


Overview

Basic Information
Taxon OID3300032699 Open in IMG/M
Scaffold IDGa0214494_1009095 Open in IMG/M
Source Dataset NameMetatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1620
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.39Long. (o)-85.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006732Metagenome / Metatranscriptome365Y
F083626Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0214494_10090951F083626N/AVARIFALIARVHRVLHRVSCSYETIPNAPKYYKGPMGWIGCVRCKKSRRHFMARTLALIAPIHPILHRVSCSYEMIPNAPKHYERHQNMSLGSNGMDQVRLLGKITTXLRGTNFCINCTSSPRFAPSFMQLRKDNKCTQTLXNAPKHEFRVQWGGLGALVAKNYNATSWHKLLH
Ga0214494_10090952F006732N/AMAQTFALIAPVQYVLQQVSCSYETIPNAPKHYETHQNMSLGANGVDXVHSLRKIPMRLRGKNFCINCTSSARFPPSLLP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.