NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315742_11553697

Scaffold Ga0315742_11553697


Overview

Basic Information
Taxon OID3300032756 Open in IMG/M
Scaffold IDGa0315742_11553697 Open in IMG/M
Source Dataset NameForest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)711
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Vannellidae → Vannella → Vannella robusta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameSweden: Dalarna County
CoordinatesLat. (o)60.97Long. (o)15.87Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094613Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0315742_115536971F094613N/AMSSCARRVIQNSAPLSNILNGSNLAITEGDTIHFLVTSQKGQNYQQYCNDIQLPVDPVTSIRQYTDHKTQLFSQVNLALASDSAALSEHADFIMQLRGSILTTPLLDDGPYYRGVELSDMEISQMEKLGSFFIPSFTSTSTDREKAYLKNSLLVIDAPYMCRYASTITEELSKYHSTEKEVLIACYSAYRLERIEKSNGKNIVKLFIDEINSSNNRV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.