NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335085_10000003

Scaffold Ga0335085_10000003


Overview

Basic Information
Taxon OID3300032770 Open in IMG/M
Scaffold IDGa0335085_10000003 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1509686
Total Scaffold Genes1384 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1003 (72.47%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5052Long. (o)-80.2345Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006317Metagenome / Metatranscriptome376Y
F007236Metagenome / Metatranscriptome355Y

Sequences

Protein IDFamilyRBSSequence
Ga0335085_10000003175F006317GGAVTRNKHVLCFLVILAGLAGCSSKPSEKASKPAASLDKIQGKAQILLDETTAEDTALNAGGPSVYLVDGLNRYRLFFNTAYQVEPGREYVAEGVIAQKAIDAIGDPDQGKNGYPLQSSCASVVSMAWPGLAFDVTDVDASTLRAKVKRLPARPVFLVTHIEPAGSAEQKKDADKDGAAEKKEAPEVTVAADKQRALLISSPAVLTAPLWEPEGETVRCKVVVDENGKIAELSSGSQLCEAVPWSQFRYKPTVKGSQPVRVNTEVEVRFDPRK
Ga0335085_10000003451F007236GGAMATESLADVISSLTPEEQESVKQFVEFLRRKGSSPSSPFLAAVDEFIDQHPELLRRLAQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.