NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335079_10006619

Scaffold Ga0335079_10006619


Overview

Basic Information
Taxon OID3300032783 Open in IMG/M
Scaffold IDGa0335079_10006619 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13256
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (77.78%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001742Metagenome / Metatranscriptome643Y
F002102Metagenome / Metatranscriptome593Y
F003000Metagenome / Metatranscriptome514Y
F004412Metagenome / Metatranscriptome439Y

Sequences

Protein IDFamilyRBSSequence
Ga0335079_1000661913F002102AGGAGMSKDEKEKRSKPKSGALDKFEPGGESGPLDDRNEYQQRLNSLPAEQKELADESTRFADLCQYFSQQKMDIPPSIVERVRNVSKLPAPDRTGAMKDINRELMEYLNDVGQDPGIRQ
Ga0335079_1000661916F003000N/AMKANAQFGEIHDRLIDFHMQNTKERFCDGLLRLVEDPLKPRDEHGRFRANPILLLLALVLALALGTFLLLSFVQS
Ga0335079_100066193F004412AGGAMENEPSNAEHALPPEQAAAKAAILAECERLDEAGITFVAVHFDGSGDEGVNEDIKCYATEDYAYEESEVLDANLSHLQEHFETLVPYGYEDGCGGFGDVILNVKTRKITVERNDRFEDYTTSNYEV
Ga0335079_100066196F001742GAGGMPDTETGNRGRDRQKIPRIGPEEAARVFAQCEHLLDSSPVFVENLRQVGFARFLAPLHEDILKLAVQPDSWGERTRARLISELFAGLKGIPAEDARVEEIVQFSNVVVPCFLLELGRRRQHIEIEFPANPCDSAARFALCAGPSYPVHSVNSEQLVRLVAEGGEELVGLCYFGDQRSREHIEAQLTFESPTTDS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.