NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335079_10008803

Scaffold Ga0335079_10008803


Overview

Basic Information
Taxon OID3300032783 Open in IMG/M
Scaffold IDGa0335079_10008803 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11499
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000405Metagenome / Metatranscriptome1176Y
F002835Metagenome / Metatranscriptome527Y
F011455Metagenome / Metatranscriptome291Y
F011612Metagenome / Metatranscriptome289Y

Sequences

Protein IDFamilyRBSSequence
Ga0335079_100088036F011455AGGAGMKIKSFLLVLIFALTPVMWAQEKPAQTPPPGGSQMRPEHRQHMMEMHEQEMEAMKADVEKMKSSLAQMKANLLTIKDTNELARWRNNVDMWETLVGHMDRMLKHMESMGPDMMHGPGMGGSPSSPPAEKKPQ
Ga0335079_100088037F002835GGAGMDAPFPPCPDHRHWKTLYRAAILETNKSVILQRVFEAEQAVLARGRELFYTAGAREEEEALEDALYALRAFKTAWEHTEPEVAGAAMETRAA
Ga0335079_100088038F011612N/AMPALPTQVPWRRFVCVLRKLGYTPQKGKAGSARSFSNPSRGPSVVSLREPHPGGSLRQRQLREYLRKLALAPDEFMQILEDC
Ga0335079_100088039F000405GGAGGMAYYKVRIEVWCDWNPLDSDVEEIAENISAGEAICTKREVVAVVDRPQDIEDDKAMSFFGGEEGDADESQG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.