NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335078_10034474

Scaffold Ga0335078_10034474


Overview

Basic Information
Taxon OID3300032805 Open in IMG/M
Scaffold IDGa0335078_10034474 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7516
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000451Metagenome / Metatranscriptome1124Y
F002448Metagenome / Metatranscriptome558Y
F007212Metagenome / Metatranscriptome355Y

Sequences

Protein IDFamilyRBSSequence
Ga0335078_1003447410F000451AGGAGMPRFQTVIRRARFVYSPYTANEMLSFAQVLADTIRARIQSGQNIYDQAAAPLKPGKPGRRGYPDYKSARGLQPIRDWTWSGHTLRCLKVLTVNENRAVIGFLDEAMPGRKQTAAQIAFYNNQREHQWGVSPRDRAALLAVMLNYRPLVVVAGGTELSSFRQYGAAVYYSALRPAA
Ga0335078_100344742F007212GGAMGRPSRRPLSATLYMSDWPTIDAAVNAAMQDAFGEPVVYQPVQGGLPVGDPLTITAIRHIRERAESGAAASAEEISVNPADLANFPQPGDWVTAWGIQFVVRTIRQPDAYGMVQLTLFARQSADDPS
Ga0335078_100344743F002448N/AMIHPKTLLAEWVTALQALPNLVEALGGNQNRIQFYTENAVVFGQPTQNNIRLAILAMPPGSVLVAWQGSGPGRLGNMLVFVHDFSLYLRAPEEAAVGYEDLFNWIVNDIPTNGTLRMLHTQVDPNCEPMDFYLPSARRNTIVISADGATFEYFEVPVRLIESYNP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.