NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335078_10093788

Scaffold Ga0335078_10093788


Overview

Basic Information
Taxon OID3300032805 Open in IMG/M
Scaffold IDGa0335078_10093788 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4349
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002261Metagenome / Metatranscriptome577Y
F003186Metagenome / Metatranscriptome502N
F015314Metagenome / Metatranscriptome255N
F023143Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
Ga0335078_100937882F015314GGCGGMTFRRESWARLTRGRVPPLFVLRPLKGFTSSDIGDEYPAPDMSNKVQLMRARQLYEQRRIGTLEEAAMALTKIPKSEPAKPGKEKRHGSQGGKNAR
Ga0335078_100937885F002261GGAMPDWSTIESLVDGVMLQTFGEPVVYQPVQAGAAQGDPLTVNAIRHLRPREESGATASFEEISVNPSDFPNPPAKGDWVTAWGAQYVVTTVRQPDAYGMLNLALLQRS
Ga0335078_100937886F003186N/AVINPKTILGEWVTALQACPDLVTAIGGNAGNIRAFLEGLATDNNLRLAILQLPPGSILVAWNGTTPRRLTGGALHFAHHFSLYLRAPEENSVATYADLFWLLVSAVPTDSLSWESLLHSQIDPNCYPMDMDLPSAQRNTIVVSADGATLDYFEVQATLVEQGNPGGE
Ga0335078_100937887F023143AGGAGMDSVFMQSPQGEVKEVEATVEHLTPLMVAGWHQVPGPAIVPKPVVHEDTQHGEH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.