NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335078_10251442

Scaffold Ga0335078_10251442


Overview

Basic Information
Taxon OID3300032805 Open in IMG/M
Scaffold IDGa0335078_10251442 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2411
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010187Metagenome / Metatranscriptome307Y
F020432Metagenome / Metatranscriptome224Y
F021372Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0335078_102514421F021372GAGMKPNENQNLEQILESAVVVSWADLMRGAQTGLIHIEYGFAASGSLDYLKLWSSVTRGHWLLACEYWMSPSTFHQTGVHFDNGYRSECLAH
Ga0335078_102514422F010187AGGAMRNAVYPGDLMKPDLFSGIVLLGSGALIFVALWMVVAAALSRV
Ga0335078_102514423F020432AGGAGGMMAPEQGPNRLNMKFTDCGRKVVIHLVRSLPPKISKDQKTITITFPEQRATGHKRRKEGTPPEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.