NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335080_10000018

Scaffold Ga0335080_10000018


Overview

Basic Information
Taxon OID3300032828 Open in IMG/M
Scaffold IDGa0335080_10000018 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)222078
Total Scaffold Genes199 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)131 (65.83%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004964Metagenome / Metatranscriptome417Y
F016864Metagenome / Metatranscriptome244Y
F021165Metagenome / Metatranscriptome220Y

Sequences

Protein IDFamilyRBSSequence
Ga0335080_10000018161F004964AGGAGGMCPACIASAGVVVGSAVSTGGLTALVLRVLRKKKVEKSDSKEKE
Ga0335080_1000001820F016864GAGMAAKGDVMKSLVLSAMLLLVVPSVAHAKELPDAPSVVAMNGAFFIQPSEPFQTPNVLLEKKTVDKTFLGLALVSAGATFADSYTTLFARQNWLAGKKGVCNAEVQSAYLYGTHPTPVRAYAVASVKTASSVFAAYYLKKHHKKFWSVPLIGNSIISLQGVTQNMMACN
Ga0335080_1000001843F021165GGAGLDFQLNNETYYIDLADEEGKWLVFAQTPTGVRRIPVYVDAPAEEEDLPLLVEDKGRRKIV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.