NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335070_10000023

Scaffold Ga0335070_10000023


Overview

Basic Information
Taxon OID3300032829 Open in IMG/M
Scaffold IDGa0335070_10000023 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)250110
Total Scaffold Genes229 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)146 (63.76%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5008Long. (o)-80.2398Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006317Metagenome / Metatranscriptome376Y
F019162Metagenome / Metatranscriptome231Y
F066227Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0335070_1000002312F019162N/AMSVYAVLGLLAGFALDGRIRVAVWVFLGGIAIKTVLVVLKREQD
Ga0335070_10000023211F006317AGGAGMTRNTHFFGFLVLPLAGLAGCSSAPSTKPAAPARDKIQGKALVALNESTALDAALNAGGPSVYLVDGLKRYRLFFNKAFEVSPGKEYVAEGIYAQKAIDAIGDPGQGTNGYPPEASCGRVVRMAWPGLAFDVTDSYASSLRAKVNRFPARAVFLVTGIQLAPSATDSAKKKDDAGNEEKEEPKVSVPADKQSALLIEGPTVLPAPLWEPSGGTAHCKVVVDEEGKIAELNSGAQLCETVPWSQFRYKPAVKGGHPIRVNTEVEVRFDKRT
Ga0335070_10000023219F066227AGGAGMLNMKWTVSAIMLAAALAGTTPQASAQSQHYRGDFDLPFEARFGNVILQPGSYTVSMLEGAKGIRITGDKGSVSILAASYDLTPGTEKGRMVLVDSHGIYALRSFESGAIGKALHFPVWKNPRGAAERTAAKLDVGMP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.