NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335070_10007792

Scaffold Ga0335070_10007792


Overview

Basic Information
Taxon OID3300032829 Open in IMG/M
Scaffold IDGa0335070_10007792 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12546
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5008Long. (o)-80.2398Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000042Metagenome / Metatranscriptome3762Y
F000309Metagenome / Metatranscriptome1327Y
F001829Metagenome / Metatranscriptome629Y
F018587Metagenome / Metatranscriptome234Y

Sequences

Protein IDFamilyRBSSequence
Ga0335070_1000779210F001829AGGMKKQYLHLSAFPCDACCGPVVAGSLAVRENEISKETDIRQVGAICLSCGHRQSAATAPARARNLQPMEWAPAETIEASHLTTAFVEALNRADLH
Ga0335070_1000779215F000309AGGMHPACPNRTGAVGRTQTHAVYDFCQSAATDRKQAIVNPNGNLERILESAVVLSWADLMRGTPTGLIHVEYGFATGGTLDYLKVWSSLSRGHWLLACAYWMSANTFHAAGIGFANGYQSEGLSHVLDIAMQHQNSFVLPPNLGRQGLLQISTPTVEESAAAAAMVKGAFDRLSSSPA
Ga0335070_1000779217F000042GGAGMTNIKFVVRVNRGAARAPAYVQRFDPTLVQMTTNRKLALIMGKFTAEDAIKSIENSRCIPELVPVNVNI
Ga0335070_100077928F018587GGAGMSAISHPFLARIRSLRAFLAAALRKSLRMEPHNGDFASQRVCPFCGRITPRYETCCLECGRVLKPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.