NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335070_10016299

Scaffold Ga0335070_10016299


Overview

Basic Information
Taxon OID3300032829 Open in IMG/M
Scaffold IDGa0335070_10016299 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8626
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (72.22%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5008Long. (o)-80.2398Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000042Metagenome / Metatranscriptome3762Y
F012173Metagenome / Metatranscriptome283Y
F018587Metagenome / Metatranscriptome234Y
F018799Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
Ga0335070_1001629910F018587GGAGMEIALHPLIVRVRSLRAFIAASLRKMLRMEPHDGDFASQRVCPFCGLITPRYETCCLECGKALKAA
Ga0335070_1001629914F018799GGAMSANTFHSAGVGFENGYKSEALAHILEITMQHQNSFVLPPNLGRQGLLQISTPTAEETAAAAGLIKTAFDRLASFPAVI
Ga0335070_1001629916F000042AGGAGMKNIKFVVRVSRGGDRAPSYVQRIDPTPVQMTTNRKLALTMGKLTAEDAVKCLQTSQCIPELVPVPVVG
Ga0335070_100162995F012173N/AMNTIMPPASLLSAPTPGGVKKKRVLLVDTCQAKRELRAEVMRKFGMDVDCAANADEARSWWRADFYDLVLINMEQSREYRDKFCDDVRRATPPQRLAFLVGQPEYLADSPNVNEEVLLKKADDEVMDDMSLALAADRGDPTQRWGILEASRRISAVRSKSRARTQAMRALPDLPRDSEGRASKRTPTATNLDDLLREELR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.