NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335069_10509216

Scaffold Ga0335069_10509216


Overview

Basic Information
Taxon OID3300032893 Open in IMG/M
Scaffold IDGa0335069_10509216 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1394
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5008Long. (o)-80.2398Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003186Metagenome / Metatranscriptome502N
F098291Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0335069_105092163F003186N/AMPTACSTWHSCNAQVDGSVINPKTILGEWVTALQSCPDLVTAIGGDGSNIRAFMEGLAADNNLRLAILQMPPGSILVAWNGTTPRRLTGGALHFAHRFSIYLRAPEQNSTATYADLFWLLVSAIPTGAPSWSSLLHFQIDPGCYPMDMDLPSAQRNTVVVSADGATLDYFEVQATLVEQGNPGGE
Ga0335069_105092164F098291N/AYQPVQSGAAQGDPFTVTAIRHLRPREESGAVANFEEISVNPSDFSNPPAKGDWVTAWGTQYVVTTVRQPDAYGMLNLALLQRAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.