NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335075_10352321

Scaffold Ga0335075_10352321


Overview

Basic Information
Taxon OID3300032896 Open in IMG/M
Scaffold IDGa0335075_10352321 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1601
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonosporobacteraceae → Ktedonosporobacter → Ktedonosporobacter rubrisoli(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007233Metagenome / Metatranscriptome355Y
F033134Metagenome178Y
F037842Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0335075_103523212F007233GGAGMANRIQKEPKRQLNLDTFSNGIKGKVLEAVSISNELECRYISLEFEDKTELTITMDTRLTGKLELFDCKTGDHRLVRKIGLIPDDTPVWRPKD
Ga0335075_103523213F033134AGGAMKQEQGSKQLITFNSLHIEVRGPRELANNQLAIRSVKEFLHAVESDVRNLLRERAETSPILEGFRLLFG
Ga0335075_103523214F037842AGGAGGLKQKTVKARGELEYPSLIGKVIRQVRFANDEDYTALTIEFDDSTLVSFRFKASIAFSIDPELSTVRGGNIVRWKRLKTRPAMKQVTK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.