Basic Information | |
---|---|
Taxon OID | 3300032955 Open in IMG/M |
Scaffold ID | Ga0335076_11656016 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 528 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Florida | |||||||
Coordinates | Lat. (o) | 26.5059 | Long. (o) | -80.2517 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042447 | Metagenome / Metatranscriptome | 158 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0335076_116560161 | F042447 | N/A | AQHYMASGGRRRDDARKEAERRAHMSGTQQLLELDGVDEDVLNVLAGANIHSPEDLIKTPIEAIATSTGIDMGDLARLRQRAISWLSEVSS |
⦗Top⦘ |