Scaffold Ga0346503_1114935

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0346503_1114935

Scaffold Ga0346503_1114935

Overview

Basic Information
Taxon OID	3300033002 Open in IMG/M
Scaffold ID	Ga0346503_1114935 Open in IMG/M
Source Dataset Name	Soil microbial community from agricultural field in Dibrughar, Assam, India - D1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Eurofins Genomics India Pvt Ltd.
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	642
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Crude Oil Contaminated Agricultural Soil Mecrobial Communities From Various Regions In India

Source Dataset Sampling Location
Location Name	Dibrughar, Assam, India
Coordinates	Lat. (^o)	26.2006043	Long. (^o)	92.9375739	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087658	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0346503_11149351	F087658	N/A	MFDPIEPMPQALYFEITLEPHLKRSGLTTGRKILFLAEVPTNNAKEASQAPDDNGAVYKAAETLAANLTCMAMTGAARQLGEDEMRISFHSLPQMSNDLKERRPDAERDGVRVWLIGARP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.