NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335084_10331062

Scaffold Ga0335084_10331062


Overview

Basic Information
Taxon OID3300033004 Open in IMG/M
Scaffold IDGa0335084_10331062 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1572
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5052Long. (o)-80.2345Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025584Metagenome / Metatranscriptome201Y
F037102Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0335084_103310621F025584N/ARRWGVFWIHYEAEELRVHHRATIPAAAARAVVVTLLASGRVPPLQPTLFDFEAAAARPGLHRFWGTACRRDEVIYLILFINDRCLVLTVSG
Ga0335084_103310622F037102AGGAGGMNEPAPDLTQQVLLPAMHAKLLLRAAELVALGWTRGTAARDANGEKVRSTAPQATAWCIVGAVDRALYELWSLDVYALLGLEVEAYDTAPCPLAVQRALRRPVQRVLGRRGLAHWNDHVCPGPAAAEQMLLAAAAETMATTDRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.