NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335073_10080863

Scaffold Ga0335073_10080863


Overview

Basic Information
Taxon OID3300033134 Open in IMG/M
Scaffold IDGa0335073_10080863 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4246
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044617Metagenome / Metatranscriptome154N
F051804Metagenome / Metatranscriptome143Y
F061074Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0335073_100808632F044617AGGAGGMPATTNQAQHKPAVAPITGEERTELDERIRRKHERLRNRYPEIHDKVVDWVHHYVEEGTLYVCIRFQDKTDFALEFRPQIVRVGTELCDSATEDFDVIRNYYQEQSE
Ga0335073_100808633F051804AGGAMAKHKPVICIQVIIDVVGPADASRKRIRFVADILRNCIRTLDKDFRKSRIPQMKGFSLKLPRRRHEAKP
Ga0335073_100808636F061074AGGAGMATKRKNPIEHHPRCRGRKCRSCTWDSMHINVDGPHARYTKGHRGQYNGDIDGAIDDFLVVLKGEARRLLRKCAEDTPALGEFHLDFG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.