NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335073_10569911

Scaffold Ga0335073_10569911


Overview

Basic Information
Taxon OID3300033134 Open in IMG/M
Scaffold IDGa0335073_10569911 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1273
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F019896Metagenome / Metatranscriptome227Y
F036729Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0335073_105699111F036729N/AMIHHPENPRREMSNGEAGVVGAVLGFGLIALALYLVVARFHIRKEQLVEAGLYLFIITAAVLTPVLRKFSKP
Ga0335073_105699113F001473GGAGMQPEYQTVSQMYERLLLMIRQRNDTGFRLAVDDAVLQPRNPFEPANKRRPKPTVTIAVSLFAVLALVFSYFSCQHKG
Ga0335073_105699114F019896N/AQTFRTGRPTAVSLNIVRFDRSLWTFQNSQLGVDVASRLRADDTPIPVKVTQSEPGIAEVAPGAVRLGVMALELPAAKPDAKKTQPTVLQILFPVDRSGNLTATLVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.