NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272431_10437430

Scaffold Ga0272431_10437430


Overview

Basic Information
Taxon OID3300033181 Open in IMG/M
Scaffold IDGa0272431_10437430 Open in IMG/M
Source Dataset NameRock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)564
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Victoria Land
CoordinatesLat. (o)-77.6Long. (o)161.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058564Metagenome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0272431_104374301F058564GAGGMTPHERAADVAPIQAGTPDDGVPYAGCGQPLAAPADAGIVWTCPYCGSDDLRVLYDERRACRVSTLNDTGDPADAAPWPSYAGDELVDIDPASFTFHCDACNSHDITPRKGGGINDLDHQQAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.