NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326727_10000191

Scaffold Ga0326727_10000191


Overview

Basic Information
Taxon OID3300033405 Open in IMG/M
Scaffold IDGa0326727_10000191 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)266341
Total Scaffold Genes263 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)170 (64.64%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000281Metagenome / Metatranscriptome1382Y
F005676Metagenome / Metatranscriptome393Y
F006614Metagenome / Metatranscriptome368Y
F046612Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0326727_10000191119F005676N/AMTMPMLIPLDAVVTLRQVNENLRAALLRLRPERTRCSSITPHDFSGILRQLLRAAECLRRPSANSDAAAALQQQALEYRGNLEKLRRFLPDVHLRLLAEKARLETARARLATAAEWAQARKTTL
Ga0326727_10000191122F046612GAGMNAIDTSLPELSKLIEQRLALVRSLAESLESSSLALARNDAEAIARGAAHQAELCRQWSHLEPELRSQAGSRSPAEAGGSARLQAQWEALGVRIRHVTRVHWSLLRHLERSLAIMHRLVDSCAPTYRPNLGLLQTTVKSEFHPRTGE
Ga0326727_10000191195F006614GGAGGMAIHVENLGDLAVITCKGRIVGSAAVFKLRDVVLSQLHSGRTNVRTIALDLSEVTTMGGGGLGMLVYLRHWAGAQGIAFKLFSPSTPVVEGLVSNRSIQNFEIASFHEMMDILAHSDRRHELAA
Ga0326727_1000019131F000281N/AMPQSVKERVGKLRAEIAEISEANRQYLQGGKKAIGASDQERRLQRLQEIMDELMSLTEWKKT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.