NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315913_1096167

Scaffold Ga0315913_1096167


Overview

Basic Information
Taxon OID3300033430 Open in IMG/M
Scaffold IDGa0315913_1096167 Open in IMG/M
Source Dataset NameMedicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)543
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.06Long. (o)-118.44Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031773Metagenome181Y

Sequences

Protein IDFamilyRBSSequence
Ga0315913_10961671F031773N/AFGLTKKSYVPRVARRFNRKNFFRNSCFYVFMTRYFFLISISNCSLDFLSIXGDRNTIYKTHDSGDQKIESLCVSWWSLLYNFSLAYSSTCSIHQKHPAAPHNGPNHHQSRISTGVLIRLFPSPEIQVSTGKDLLIPRGRAGLEASYLSPISPPFLLLVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.