NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316613_10885903

Scaffold Ga0316613_10885903


Overview

Basic Information
Taxon OID3300033434 Open in IMG/M
Scaffold IDGa0316613_10885903 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)613
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Soil Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3777Long. (o)-82.5117Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105443Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0316613_108859031F105443AGGLPSTTPQPPVPHARLIGMPIGAWLVLGFALVIGAFAAASVVSLRSTHEATADLANMQQQFEPLSRSVRDLGDGLATFDRTVLAYLRADSRDNHAAVLATAQRLSQAANRTLDVGAAGESLPVGPLLQRIADHEADGFRLLDLQDERRRTIGGLEQAYESLDRRIKGAGGAGVVVGNSL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.