NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326765_103584

Scaffold Ga0326765_103584


Overview

Basic Information
Taxon OID3300033476 Open in IMG/M
Scaffold IDGa0326765_103584 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Norris Geyser Basin, Yellowstone National Park, WY, United States - NOR.RB_P
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1792
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7265Long. (o)-110.709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024139Metagenome / Metatranscriptome207Y
F036314Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0326765_1035841F036314GGAGGMSQVPGSQEGVPQGSQAPQLSEEEREKAIDGAMIGVALAQLGILEIELMLAGCLSHPDAFALESMHRRANEALDSNDLDKALQWADKITKFLEERQKLCEELRKKSRKHNKRYSRHSSRH
Ga0326765_1035842F024139GGAGGMAQEVAQGEALKKTLNLEITVYQDPEDKLRYKADITVDGWTISIGGWLVRKYVLEDIDMELQNAWTHLGFAERAKTEESRKLDLDMLLLHLEHALARILAYEIAKDIPDAVIKEEICNRWWKAVGEKECAYTECADFVKEDFDACMETCKKEWCGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.