NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326763_1025716

Scaffold Ga0326763_1025716


Overview

Basic Information
Taxon OID3300033484 Open in IMG/M
Scaffold IDGa0326763_1025716 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Norris Geyser Basin, Yellowstone National Park, WY, United States - NOR.PS_P
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)978
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7265Long. (o)-110.7091Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013155Metagenome / Metatranscriptome274Y
F075483Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0326763_10257161F075483AGGAGMIELLAVQAITNLALAAVVIKLRRELWPMIAGAGPSPVRGFWIRSIDVLLVEMPLLRVAKSVTRVRWLFSEELHLTYRLRVYDVAMLPGTRHHYVRWKAWMQGDDRYKCEVEKPRGLSRLYNKAIDVFCREVKKDEKKEVVILPSRWRKRRYKRWRKPTPS
Ga0326763_10257162F013155GAGMELYQVVVIAIALANLAVTIWLLRLLIPIWQTLRRIVFALDNFDFDEISKKFLSNEKPLAETIDVKVSEKKEEGYRELTVTRVYKKPLDAKEVWEGIVRQMAQEMQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.