Scaffold Ga0326760_1000838

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0326760_1000838

Scaffold Ga0326760_1000838

Overview

Basic Information
Taxon OID	3300033490 Open in IMG/M
Scaffold ID	Ga0326760_1000838 Open in IMG/M
Source Dataset Name	Hot spring sediment microbial communities from Geyser Creek Basin, Yellowstone National Park, WY, United States - GCR.EP_S
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14674
Total Scaffold Genes	28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	24 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota → Candidatus Methanodesulfokores → Candidatus Methanodesulfokores washburnensis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.6904	Long. (^o)	-110.7291	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104050	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326760_100083819	F104050	AGGTGG	VSEVKKCIIGLRRHCIVYDALVSDERQKYGTKEFVITYCGMCIKTVYAKAKRKLVNKYSVVNTL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.