NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316616_102259629

Scaffold Ga0316616_102259629


Overview

Basic Information
Taxon OID3300033521 Open in IMG/M
Scaffold IDGa0316616_102259629 Open in IMG/M
Source Dataset NameWetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)725
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Wetland Microbial Communities From Old Woman Creek Delta, Ohio, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3776Long. (o)-82.5117Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001120Metagenome / Metatranscriptome772Y
F001807Metagenome / Metatranscriptome631Y
F020342Metagenome / Metatranscriptome224Y

Sequences

Protein IDFamilyRBSSequence
Ga0316616_1022596291F001120N/AKTIAGFNVTEHGIKSYTKSFQLGPFQLTLNARESGVRGSISIPGTGLSKRNVKLF
Ga0316616_1022596292F020342N/AMSAVTNNLNLFDRINLADCAKRRASENVLDSTRFSSEYGTARLWMKYRCNIAPNHSYVET
Ga0316616_1022596293F001807GGAGMTVLAIEHTSFTDTHVTITAVVDGMRLLYRATYFEPEEWAPALCETTIELDPEEPIPLDEDGFCAYLDQLDPQWQLVDTSVDDFD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.