NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316214_1030040

Scaffold Ga0316214_1030040


Overview

Basic Information
Taxon OID3300033545 Open in IMG/M
Scaffold IDGa0316214_1030040 Open in IMG/M
Source Dataset NameSpruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)771
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9992Long. (o)10.7901Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014282Metagenome / Metatranscriptome264Y
F028867Metagenome / Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0316214_10300401F028867N/AALKFRYSRLIGDAPGATCDATTIPACPITPVIAPPFYEHTDQFTFGVNWYLNYWVMVKSEVSLDQLKTPSVQGILPRNYYVFLETLQFRF
Ga0316214_10300402F014282GGAGMKTKMVPLRNLLALLGALFVLNSCGGGGSSSDCPVCGTQKNGPIGLIDVMLVPEHNPNGEPGGPFNIFDISWVDPTTRTYTVSDRIGLDVPVFSTTSNIALWAIGGDNSIAEAGDNASSCWVDTSTTATAGETIPPITTAQGNYTRF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.