NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314865_024789

Scaffold Ga0314865_024789


Overview

Basic Information
Taxon OID3300033806 Open in IMG/M
Scaffold IDGa0314865_024789 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1514
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NamePeru: Loreto
CoordinatesLat. (o)-6.3272Long. (o)-74.8136Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034274Metagenome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0314865_024789_3_1214F034274N/ASAWTTLSGGVENIVVPSMLVTQAGTELVSFESPNGDTISVARAGGAAKVIVANDPIAGRTQLVQQPNGAIQLYFPNAAGVGRMTSTDDGNSWTGPIQTQSHTVGGVQGSALMPDGTPLFSQDGTGFVNVFRGLNGETVKNVYTRCCGYAESLAVDTAGLVQVAFYSNADPDGAFVYEPLGADLTPGAPTVLKPTAPHDDRVPLVSDHSGNTFMAWPPGYPTATAFTVVPFRGGQPAGDGVTFHASFGGGDPHMALSVDSSDRLWAAWTGGGAVHVARSRTHGMDFGATVSAPVSGTAYQISAVGLPGDPGKIDVIVNTGSSLIEQQLPPGLSVKVSKTTKKAGKKTVTTWWAQALDDGAPVPTATFTVGGHTVHADATGKAKVPSGSGKAAAPGYAGASFRVP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.